Structure of PDB 4q10 Chain B Binding Site BS01

Receptor Information
>4q10 Chain B (length=295) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDAVKNSHI
TGFFRRICKLLYFGIRPVFVFDGGVPVLKRETIRDEVTMDMIKEVQELLS
RFGIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIYKNMFH
EKNYVEFYDAESILKLLGLDRKNMIELAQLLGSDYTNGLKGMGPVSSIEV
IAEFGNLKNFKDWYNNGQFNKFEKDLRKKLVNNEIILDDDFPSVMVYDAY
MRPEVDHDTTPFVWGVPDLDMLRSFMKTQLGWPHEKSDEILIPLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4q10 Crystal structure of the catalytic core of Rad2: insights into the mechanism of substrate binding.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		I33 Y36 K40 V767
Binding residue
(residue number reindexed from 1)		I32 Y35 K39 V87
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0006289 nucleotide-excision repair
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4q10, PDBe:4q10, PDBj:4q10
PDBsum4q10
PubMed25120270
UniProtP07276|RAD2_YEAST DNA repair protein RAD2 (Gene Name=RAD2)

[Back to BioLiP]