Structure of PDB 4pz3 Chain B Binding Site BS01

Receptor Information

>4pz3 Chain B (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKA
LSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCF
NASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIY
P

Ligand information

>4pz3 Chain C (length=4) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4pz3 High-resolution crystal structures of alternate forms of the human CD44 hyaluronan-binding domain reveal a site for protein interaction.
Resolution	1.083 Å
Binding residue (original residue number in PDB)	F34 N57 N120 V132 P136
Binding residue (residue number reindexed from 1)	F15 N38 N101 V113 P117

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005540	hyaluronic acid binding

	Biological Process
GO:0007155	cell adhesion

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4pz3, PDBe:4pz3, PDBj:4pz3
PDBsum	4pz3
PubMed	25195884
UniProt	P16070\|CD44_HUMAN CD44 antigen (Gene Name=CD44)

[Back to BioLiP]