Structure of PDB 4pv1 Chain B Binding Site BS01

Receptor Information

>4pv1 Chain B (length=159) Species: 83541 (Mastigocladus laminosus)

ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACI
VALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLM
ASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPL
DKTLTLGLF

Ligand information

>4pv1 Chain H (length=28) Species: 83541 (Mastigocladus laminosus)

EIDVLGWVALLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4pv1 Traffic within the cytochrome b6f lipoprotein complex: gating of the quinone portal.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): C50 L57
• Binding residue (residue number reindexed from 1): C49 L56

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E77

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4pv1, PDBe:4pv1, PDBj:4pv1
• PDBsum: 4pv1
• PubMed: 25296314
• UniProt: P83792|PETD_MASLA Cytochrome b6-f complex subunit 4 (Gene Name=petD)