Structure of PDB 4pn1 Chain B Binding Site BS01

Receptor Information
>4pn1 Chain B (length=261) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VAVPKIEMNFLNKPIVPDTTKVISNFLTHYLITEPVEHVEIEAKLGTLID
LETQNRFEFPVMNETILNPEFNLRTRFESDMTASEHKYLNEFLNQAFRDS
QKPGRLPFAYKHTKQVDLFYETEDKIRVSKNQSDNQVLACVKKRRVADLF
LYCPNDAFDIRISISDELPVSMPSGNQQPSLTRLKDRVGYVHQEIKIDLT
KTTQNDPVYDTTERHELEVEFGNIADLRDRAQKAKDGMEAPLFRRVQLFM
DNVRILRREHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pn1 Fission yeast RNA triphosphatase reads an Spt5 CTD code.
Resolution2.803 Å
Binding residue
(original residue number in PDB)		V60 N63 F64 H67 E108
Binding residue
(residue number reindexed from 1)		V22 N25 F26 H29 E70
Enzymatic activity
Catalytic site (original residue number in PDB) E78 E80 R169 K185 K227 E262
Catalytic site (residue number reindexed from 1) E40 E42 R127 K143 K185 E220
Enzyme Commision number 3.6.1.74: mRNA 5'-phosphatase.
Gene Ontology
Molecular Function
GO:0004651 polynucleotide 5'-phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0099122 RNA polymerase II C-terminal domain binding
GO:0140818 mRNA 5'-triphosphate monophosphatase activity
Biological Process
GO:0006370 7-methylguanosine mRNA capping
Cellular Component
GO:0005634 nucleus
GO:0031533 mRNA capping enzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pn1, PDBe:4pn1, PDBj:4pn1
PDBsum4pn1
PubMed25414009
UniProtQ9P6Q6|CET1_SCHPO mRNA-capping enzyme subunit beta (Gene Name=pct1)

[Back to BioLiP]