Structure of PDB 4pmi Chain B Binding Site BS01

Receptor Information
>4pmi Chain B (length=53) Species: 11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSLKAVRLIKFLYQSNPPPNPEGTRQARRNRRRRWRARQRQIHSISERIR
STY
Ligand information
>4pmi Chain A (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggaguauaugggcgcacuucggugacgguacaggcuccu
<<<<<<...<<..<<<<<....>>>.>>...>>.>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pmi RNA-directed remodeling of the HIV-1 protein Rev orchestrates assembly of the Rev-Rev response element complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T34 R35 Q36 A37 R38 R39 N40 R41 R43 R44 R48 R50
Binding residue
(residue number reindexed from 1)		T24 R25 Q26 A27 R28 R29 N30 R31 R33 R34 R38 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pmi, PDBe:4pmi, PDBj:4pmi
PDBsum4pmi
PubMed25486594
UniProtP69718|REV_HV1H3 Protein Rev (Gene Name=rev)

[Back to BioLiP]