Structure of PDB 4pl6 Chain B Binding Site BS01

Receptor Information
>4pl6 Chain B (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRL
DCLLKHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pl6 Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
Resolution1.681 Å
Binding residue
(original residue number in PDB)		Y67 Y87 W90
Binding residue
(residue number reindexed from 1)		Y17 Y37 W40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pl6, PDBe:4pl6, PDBj:4pl6
PDBsum4pl6
PubMed25211338
UniProtQ4V3E2|MRG2_ARATH Protein MRG2 (Gene Name=MRG2)

[Back to BioLiP]