Structure of PDB 4p3w Chain B Binding Site BS01

Receptor Information

>4p3w Chain B (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMG
THTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAE
FSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVS
VKFNEEHIPDSPFVVPVASPS

Ligand information

>4p3w Chain G (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EKRVASSVFITLAPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4p3w Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide
Resolution	2.0 Å
Binding residue (original residue number in PDB)	G2223 P2225 F2226 Q2227 T2229 E2313 E2314 H2315 P2320
Binding residue (residue number reindexed from 1)	G65 P67 F68 Q69 T71 E155 E156 H157 P162

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0051015	actin filament binding

	Biological Process
GO:0030036	actin cytoskeleton organization

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4p3w, PDBe:4p3w, PDBj:4p3w
PDBsum	4p3w
PubMed
UniProt	P21333\|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]