Structure of PDB 4p3e Chain B Binding Site BS01

Receptor Information
>4p3e Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFL
EKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMI
PKLKT
Ligand information
>4p3e Chain A (length=124) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacuaaguucggcaucaauauggugaccucccgggagcgggggaccacca
gguugccuaaggaggggugaaccggcccaggucggaaacggagcagguca
aaacucccgugcugaucaguaguu
<<<<.<..<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>>>
.>>>>........<<<<<......<<<....<<<....>>>....>>>..
..>>>>>.>>>>>>>....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p3e SRP RNA remodeling by SRP68 explains its role in protein translocation.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 I37 K66 M67 Y68 S69 R70 R74 R81 R101
Binding residue
(residue number reindexed from 1)		F3 I4 C5 Y7 Y10 T16 I17 R21 R22 P24 I25 K54 M55 Y56 S57 R58 R62 R69 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4p3e, PDBe:4p3e, PDBj:4p3e
PDBsum4p3e
PubMed24700861
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]