Structure of PDB 4p2q Chain B Binding Site BS01

Receptor Information
>4p2q Chain B (length=171) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTE
LGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVY
PLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLE
TVYTCQVEHPSLTDPVTVEWK
Ligand information
>4p2q Chain C (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADGLAYFRSSFKGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p2q Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S13 L26 D57 W61 E74 V78 H81 N82 I85 F86
Binding residue
(residue number reindexed from 1)		S11 L24 D55 W59 E72 V76 H79 N80 I83 F84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4p2q, PDBe:4p2q, PDBj:4p2q
PDBsum4p2q
PubMed24855945
UniProtQ31163

[Back to BioLiP]