Structure of PDB 4ozh Chain B Binding Site BS01

Receptor Information
>4ozh Chain B (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILV
MLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ozh T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
F11 S28 A57 Y60 W61 I67 K71 R77 V78 N82 L85
Binding residue
(residue number reindexed from 1)
F9 S26 A55 Y58 W59 I65 K69 R75 V76 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ozh, PDBe:4ozh, PDBj:4ozh
PDBsum4ozh
PubMed24777060
UniProtQ5Y7D3

[Back to BioLiP]