Structure of PDB 4oz1 Chain B Binding Site BS01

Receptor Information
>4oz1 Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNS
AQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSM
TATQLLVPSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oz1 Cancer-relevant splicing factor CAPER alpha engages the essential splicing factor SF3b155 in a specific ternary complex.
Resolution1.74 Å
Binding residue
(original residue number in PDB)		M425 D443 E447 L485 R488 W489 F490 A491 G492
Binding residue
(residue number reindexed from 1)		M12 D30 E34 L72 R75 W76 F77 A78 G79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4oz1, PDBe:4oz1, PDBj:4oz1
PDBsum4oz1
PubMed24795046
UniProtQ14498|RBM39_HUMAN RNA-binding protein 39 (Gene Name=RBM39)

[Back to BioLiP]