Structure of PDB 4oyk Chain B Binding Site BS01

Receptor Information
>4oyk Chain B (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAAR
LVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVF
RSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLL
LRTELSLLLQNTHPRQQALEQLL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oyk Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
Resolution2.0001 Å
Binding residue
(original residue number in PDB)		K81 Y82 N85 P92 Y94 G97 V98 K99 N101 N102 V104
Binding residue
(residue number reindexed from 1)		K76 Y77 N80 P87 Y89 G92 V93 K94 N96 N97 V99
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4oyk, PDBe:4oyk, PDBj:4oyk
PDBsum4oyk
PubMed24726323
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]