Structure of PDB 4owx Chain B Binding Site BS01

Receptor Information

TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISV
WDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSE
VPNFSEP

Ligand information

ttttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

PDB	4owx Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	G13 K15 T32 K33 W55 D56 Y74 F78 Y85 T86 R88
Binding residue (residue number reindexed from 1)	G9 K11 T28 K29 W51 D52 Y70 F74 Y81 T82 R84
Binding affinity	PDBbind-CN: Kd=8.2uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003697	single-stranded DNA binding
GO:0005515	protein binding
GO:0061730	C-rich strand telomeric DNA binding
GO:0070182	DNA polymerase binding
GO:0098505	G-rich strand telomeric DNA binding

	Biological Process
GO:0000724	double-strand break repair via homologous recombination
GO:0006281	DNA repair
GO:0006974	DNA damage response
GO:0010212	response to ionizing radiation
GO:0044818	mitotic G2/M transition checkpoint
GO:0070200	establishment of protein localization to telomere
GO:1904355	positive regulation of telomere capping

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005829	cytosol
GO:0035861	site of double-strand break
GO:0070876	SOSS complex

External links

PDB	RCSB:4owx, PDBe:4owx, PDBj:4owx
PDBsum	4owx
PubMed	24630995
UniProt	Q9BQ15\|SOSB1_HUMAN SOSS complex subunit B1 (Gene Name=NABP2)