Structure of PDB 4owf Chain B Binding Site BS01

Receptor Information
>4owf Chain B (length=86) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADI
YKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Ligand information
>4owf Chain G (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RGRWACQSCTFENEAAAVLCSICERPRLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4owf Mechanism Underlying I kappa B Kinase Activation Mediated by the Linear Ubiquitin Chain Assembly Complex.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E264 L267 V268 Q271
Binding residue
(residue number reindexed from 1)		E14 L17 V18 Q21
Enzymatic activity
Enzyme Commision number 6.3.2.-
External links
PDB RCSB:4owf, PDBe:4owf, PDBj:4owf
PDBsum4owf
PubMed24469399
UniProtO88522|NEMO_MOUSE NF-kappa-B essential modulator (Gene Name=Ikbkg)

[Back to BioLiP]