Structure of PDB 4ot4 Chain B Binding Site BS01

Receptor Information

>4ot4 Chain B (length=116) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVC
SQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIV
ACEGNPYVPVHFDASV

Ligand information

• Ligand ID: CPT
• InChI: InChI=1S/2ClH.2H3N.Pt/h2*1H;2*1H3;/q;;;;+2/p-2
• InChIKey: LXZZYRPGZAFOLE-UHFFFAOYSA-L
• SMILES:
  OpenEye OEToolkits 1.7.6: [NH3][Pt]([NH3])(Cl)Cl
  ACDLabs 12.01: [Pt](N)(N)(Cl)Cl
  CACTVS 3.385: N|[Pt](|N)(Cl)Cl
• Formula: Cl2 H6 N2 Pt
• Name: Cisplatin;
  diammine(dichloro)platinum
• DrugBank: DB00515
• PDB chain: 4ot4 Chain B Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ot4 Cisplatin binding to proteins: molecular structure of the ribonuclease a adduct.
• Resolution: 1.85 Å
• Binding residue (original residue number in PDB): D14 Y25 Q28 M29
• Binding residue (residue number reindexed from 1): D14 Y17 Q20 M21
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H12 K41 H119 F120 D121
• Catalytic site (residue number reindexed from 1): H12 K33 H111 F112 D113
• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:4ot4, PDBe:4ot4, PDBj:4ot4
• PDBsum: 4ot4
• PubMed: 24694179
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)