Structure of PDB 4omy Chain B Binding Site BS01

Receptor Information
>4omy Chain B (length=97) Species: 380 (Sinorhizobium fredii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLS
QSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4omy Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
Resolution3.062 Å
Binding residue
(original residue number in PDB)		N28 R31 S57 Q61 H62 R76 A78 Q79
Binding residue
(residue number reindexed from 1)		N23 R26 S52 Q56 H57 R71 A73 Q74
Binding affinityPDBbind-CN: Kd=0.43uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4omy, PDBe:4omy, PDBj:4omy
PDBsum4omy
PubMed24733893
UniProtQ83TD2

[Back to BioLiP]