Structure of PDB 4oln Chain B Binding Site BS01

Receptor Information

>4oln Chain B (length=67) Species: 32630 (synthetic construct)

KRLCQVCGDHASGFHYGVWSCEGCKAFFKRSIQDYVCPATNNCTIDKHRR
KSCQACRLRKCLEVGMT

Ligand information

>4oln Chain E (length=19)

ccaggtcagagtgacctga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4oln Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): E25 G26 A29 R33 R56 K57 Q60 R63
• Binding residue (residue number reindexed from 1): E22 G23 A26 R30 R50 K51 Q54 R57

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 17:14:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4oln', asym_id = 'B', bs = 'BS01', title = 'Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4oln', asym_id='B', bs='BS01', title='Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003700,0006355,0008270,0043565', uniprot = '', pdbid = '4oln', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003700,0006355,0008270,0043565', uniprot='', pdbid='4oln', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>