Structure of PDB 4ogq Chain B Binding Site BS01

Receptor Information

>4ogq Chain B (length=159) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

ATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACI
VALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAM
ASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPL
DKSLTLGLF

Ligand information

>4ogq Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

MAILTLGWVSLLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ogq Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
• Resolution: 2.501 Å
• Binding residue (original residue number in PDB): D35 V39 C50 L57
• Binding residue (residue number reindexed from 1): D34 V38 C49 L56

Enzymatic activity

• Catalytic site (original residue number in PDB): E78
• Catalytic site (residue number reindexed from 1): E77

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4ogq, PDBe:4ogq, PDBj:4ogq
• PDBsum: 4ogq
• PubMed: 24931468
• UniProt: Q93SX1|PETD_NOSS1 Cytochrome b6-f complex subunit 4 (Gene Name=petD)