Structure of PDB 4o62 Chain B Binding Site BS01

Receptor Information
>4o62 Chain B (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNNC
SISEEDF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4o62 Family-wide Characterization of Histone Binding Abilities of Human CW Domain-containing Proteins.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		K28 V29 W30 V31 Q32 W41 H54 E56 F78
Binding residue
(residue number reindexed from 1)		K7 V8 W9 V10 Q11 W20 H33 E35 F57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4o62, PDBe:4o62, PDBj:4o62
PDBsum4o62
PubMed26933034
UniProtQ504Y3|ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 (Gene Name=ZCWPW2)

[Back to BioLiP]