Structure of PDB 4o51 Chain B Binding Site BS01

Receptor Information
>4o51 Chain B (length=214) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGRLVTPGTPLTLTCTVSGFSLSSYPMNWVRQAPGKGLEWIGGI
GTSGNIWYASWAKGRFIISRASSTTVDLKVTSPTTEDTATYFCARGLYND
YTVWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4o51 Structure and specificity of an antibody targeting a proteolytically cleaved IgG hinge.
Resolution2.204 Å
Binding residue
(original residue number in PDB)		P32 N34 G51 S53 N55 W57 G96 Y98 Y101
Binding residue
(residue number reindexed from 1)		P32 N34 G51 S53 N55 W57 G96 Y98 Y101
External links