Structure of PDB 4nuu Chain B Binding Site BS01

Receptor Information

>4nuu Chain B (length=292) Species: 126793 (Plasmodium vivax Sal-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ASNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLFHRDI
TFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIM
GTDMEGIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSV
KKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKC
DGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEK
QTAGIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS

Ligand information

>4nuu Chain C (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QLDFEDVWNSSY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4nuu Red Blood Cell Invasion by Plasmodium vivax: Structural Basis for DBP Engagement of DARC.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	H262 R263 D264 I265
Binding residue (residue number reindexed from 1)	H47 R48 D49 I50

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046789	host cell surface receptor binding

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4nuu, PDBe:4nuu, PDBj:4nuu
PDBsum	4nuu
PubMed	24415938
UniProt	P22290\|PVDR_PLAVS Duffy receptor (Gene Name=PVDR)

[Back to BioLiP]