Structure of PDB 4nmx Chain B Binding Site BS01

Receptor Information
>4nmx Chain B (length=278) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIPWNLERITPGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGT
RFSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGL
EFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNF
RDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDI
IGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHF
SAKDVINEAWFPEDQRVLTPNLVAALPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nmx Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		D238 A239 I369 T377 C378 F379
Binding residue
(residue number reindexed from 1)		D70 A71 I201 T209 C210 F211
Enzymatic activity
Catalytic site (original residue number in PDB) D186 H226 N317 S386
Catalytic site (residue number reindexed from 1) D22 H58 N149 S218
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4nmx, PDBe:4nmx, PDBj:4nmx
PDBsum4nmx
PubMed24225950
UniProtQ8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 (Gene Name=PCSK9)

[Back to BioLiP]