Structure of PDB 4nmo Chain B Binding Site BS01

Receptor Information
>4nmo Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nmo Chemically Modified Peptide Scaffolds Target the CFTR-Associated Ligand PDZ Domain.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		I286 R345
Binding residue
(residue number reindexed from 1)		I3 R62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:4nmo, PDBe:4nmo, PDBj:4nmo
PDBsum4nmo
PubMed25136860
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]