Structure of PDB 4niq Chain B Binding Site BS01

Receptor Information
>4niq Chain B (length=78) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSK
DLIRAKFTEYLNRAEQLKKHLESEEANA
Ligand information
>4niq Chain D (length=21) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYSNTDPEELLRKHVFPSVPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4niq Vfa1 Binds to the N-terminal Microtubule-interacting and Trafficking (MIT) Domain of Vps4 and Stimulates Its ATPase Activity.
Resolution2.301 Å
Binding residue
(original residue number in PDB)		G4 L7 I11 Q15 I18 Y46 E47 K48 N49 S52 K59 E62 Y63 R66
Binding residue
(residue number reindexed from 1)		G1 L4 I8 Q12 I15 Y43 E44 K45 N46 S49 K56 E59 Y60 R63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4niq, PDBe:4niq, PDBj:4niq
PDBsum4niq
PubMed24567329
UniProtP52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]