Structure of PDB 4nf9 Chain B Binding Site BS01

Receptor Information

>4nf9 Chain B (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDV
NFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFS
LVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEI
TLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQI
YQDLFQD

Ligand information

>4nf9 Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QRKWYPLRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4nf9 Modular Assembly of RWD Domains on the Mis12 Complex Underlies Outer Kinetochore Organization.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	V2124 Y2125 T2127 S2158 L2159 L2160 P2166 S2169
Binding residue (residue number reindexed from 1)	V20 Y21 T23 S54 L55 L56 P62 S65

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0008608	attachment of spindle microtubules to kinetochore
GO:0034501	protein localization to kinetochore

View graph for
Biological Process

External links

PDB	RCSB:4nf9, PDBe:4nf9, PDBj:4nf9
PDBsum	4nf9
PubMed	24530301
UniProt	Q8NG31\|KNL1_HUMAN Kinetochore scaffold 1 (Gene Name=KNL1)

[Back to BioLiP]