Structure of PDB 4nec Chain B Binding Site BS01

Receptor Information

>4nec Chain B (length=244) Species: 324833 (Streptomyces lasalocidi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMTEVFDAVYRGESPFGKRPPWDIGAPQPAYVALEKAGLIQGAVLDAGCG
TGEDALHLAGLGYAVTGLDLSPTAISVARDKADARGLGAVFEVADALDLT
GWEERFDTVIDSGLAHTFEGDRLRAYATALHRACRPGAVAHILSISDRGS
AEMQARLAEAIDEIPAPLPDDDESPTLKRSADHLRDGFAEGWTIESIDES
LMRGVIPTTSELLDVHAWLGRFRRDWNSSSVDKLAAALEHHHHH

Ligand information

>4nec Chain F (length=8) Species: 67293 (Streptomyces echinatus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SACVSACV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4nec Conversion of a disulfide bond into a thioacetal group during echinomycin biosynthesis.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	F5 F15 W21 H115 T116 I163 L176 R178
Binding residue (residue number reindexed from 1)	F6 F16 W22 H116 T117 I164 L177 R179

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008168	methyltransferase activity

	Biological Process
GO:0009058	biosynthetic process
GO:0032259	methylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4nec, PDBe:4nec, PDBj:4nec
PDBsum	4nec
PubMed	24302672
UniProt	Q0X0A7

[Back to BioLiP]