Structure of PDB 4nb3 Chain B Binding Site BS01

Receptor Information
>4nb3 Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSD
GLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILME
LEVLKSAEAVGVKIGNPVPYNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nb3 Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		S-1 H0 V2 R7
Binding residue
(residue number reindexed from 1)		S1 H2 V4 R9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4nb3, PDBe:4nb3, PDBj:4nb3
PDBsum4nb3
PubMed24491171
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]