Structure of PDB 4mzg Chain B Binding Site BS01

Receptor Information
>4mzg Chain B (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCV
YGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGS
KDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSL
VGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mzg Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1
Resolution1.698 Å
Binding residue
(original residue number in PDB)		D95 M140 F141 E142 W151 Y170 D173 Y177 Y179 Q180 D184 D189
Binding residue
(residue number reindexed from 1)		D48 M93 F94 E95 W104 Y123 D126 Y130 Y132 Q133 D137 D142
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:4mzg, PDBe:4mzg, PDBj:4mzg
PDBsum4mzg
PubMed24589551
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]