Structure of PDB 4mzf Chain B Binding Site BS01

Receptor Information
>4mzf Chain B (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSSHHHHHHGSRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYL
IKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVE
HMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEG
DLRIMSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVY
DLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mzf Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1
Resolution2.098 Å
Binding residue
(original residue number in PDB)
W62 W72 G93 D95 Y98 F141 E142 W151 Y170 D173 Y177 Y179 Q180 D184 D189 F251
Binding residue
(residue number reindexed from 1)
W24 W34 G55 D57 Y60 F103 E104 W113 Y132 D135 Y139 Y141 Q142 D146 D151 F195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:4mzf, PDBe:4mzf, PDBj:4mzf
PDBsum4mzf
PubMed24589551
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]