Structure of PDB 4mdi Chain B Binding Site BS01

Receptor Information
>4mdi Chain B (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVYPEVTV
YPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mdi A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H13 Y30 D57 Y60 W61 E71 T77 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		H12 Y29 D56 Y59 W60 E70 T76 Y77 H80 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mdi, PDBe:4mdi, PDBj:4mdi
PDBsum4mdi
PubMed24190431
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]