Structure of PDB 4mbe Chain B Binding Site BS01

Receptor Information
>4mbe Chain B (length=50) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRKDFIDTMTRELYDAFLHERLYLIYMDSRAELKRNSTLKKKFFEKWQAS
Ligand information
>4mbe Chain G (length=9) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPTVGFDFI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mbe Structural basis for binding the TREX2 complex to nuclear pores, GAL1 localisation and mRNA export.
Resolution2.612 Å
Binding residue
(original residue number in PDB)		L768 A771 H774 E775 Y778
Binding residue
(residue number reindexed from 1)		L13 A16 H19 E20 Y23
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4mbe, PDBe:4mbe, PDBj:4mbe
PDBsum4mbe
PubMed24705649
UniProtP46674|SAC3_YEAST Nuclear mRNA export protein SAC3 (Gene Name=SAC3)

[Back to BioLiP]