Structure of PDB 4m7c Chain B Binding Site BS01

Receptor Information

>4m7c Chain B (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKE
HTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFT
LTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSPTTQKLRNDLL
NIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKAL

Ligand information

>4m7c Chain D (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SRGLEVSHRLAPW

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4m7c SLX4 Assembles a Telomere Maintenance Toolkit by Bridging Multiple Endonucleases with Telomeres
Resolution	2.05 Å
Binding residue (original residue number in PDB)	R80 M83 Q84 L87 L101 R102 M104 Q105 R109 S119 F120 D121
Binding residue (residue number reindexed from 1)	R36 M39 Q40 L43 L57 R58 M60 Q61 R65 S75 F76 D77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042162	telomeric DNA binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0000723	telomere maintenance
GO:0031848	protection from non-homologous end joining at telomere

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4m7c, PDBe:4m7c, PDBj:4m7c
PDBsum	4m7c
PubMed	24012755
UniProt	Q15554\|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]