Structure of PDB 4m4m Chain B Binding Site BS01

Receptor Information
>4m4m Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m4m Towards accurate structural characterization of metal centres in protein crystals: the structures of Ni and Cu T6 bovine insulin derivatives.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 P28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4m4m, PDBe:4m4m, PDBj:4m4m
PDBsum4m4m
PubMed24419384
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]