Structure of PDB 4lnq Chain B Binding Site BS01

Receptor Information
>4lnq Chain B (length=192) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDL
KEKFTENKFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAK
ETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDK
EQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lnq Structural mechanism of DNA recognition by the p202 HINa domain: insights into the inhibition of Aim2-mediated inflammatory signalling.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N182 D183 K184 S185 T187 K198
Binding residue
(residue number reindexed from 1)		N129 D130 K131 S132 T134 K145
Binding affinityPDBbind-CN: Kd=1.33uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4lnq, PDBe:4lnq, PDBj:4lnq
PDBsum4lnq
PubMed24419611
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]