Structure of PDB 4lmg Chain B Binding Site BS01

Receptor Information
>4lmg Chain B (length=121) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIHLDPVPSFEDRHEIKPWLQKIFYPQGIDIVIERSDSSKVTFKCRSVAC
PFRIRAAYSVRLQKWNVVVMNNIHSHELRFDLITKTDDYKKFKENLRQKN
DEKAIKTFDELEYKASLNLPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4lmg Molecular mechanism and structure of the Saccharomyces cerevisiae iron regulator Aft2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		K58 V73 I74 E75 S77 S88
Binding residue
(residue number reindexed from 1)		K17 V32 I33 E34 S36 S47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
Biological Process
GO:0010106 cellular response to iron ion starvation
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4lmg, PDBe:4lmg, PDBj:4lmg
PDBsum4lmg
PubMed24591629
UniProtQ08957|AFT2_YEAST Iron-regulated transcriptional activator AFT2 (Gene Name=AFT2)

[Back to BioLiP]