Structure of PDB 4l8r Chain B Binding Site BS01

Receptor Information
>4l8r Chain B (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKK
QKLMDSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDT
FQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKEL
GTKYKYSLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYK
VQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKM
HAGQLMSVSSSLPIEGTPPPQMPHFR
Ligand information
>4l8r Chain A (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccaaaggcucuuuucagagccaccca
.....<<<<<<....>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l8r Structure of Histone Mrna Stem-Loop, Human Stem-Loop Binding Protein, and 3'Hexo Ternary Complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y66 K67 A70 N73 G74 N77 R78 K104 K107 K111 E136 A137 C139 N143 F185 S232 W233 F238 R261 K262 N266 K276 S332
Binding residue
(residue number reindexed from 1)		Y4 K5 A8 N11 G12 N15 R16 K42 K45 K49 E67 A68 C70 N74 F116 S163 W164 F169 R192 K193 N197 K204 S260
Enzymatic activity
Catalytic site (original residue number in PDB) D134 E136 D234 H293 D298
Catalytic site (residue number reindexed from 1) D65 E67 D165 H221 D226
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4l8r, PDBe:4l8r, PDBj:4l8r
PDBsum4l8r
PubMed23329046
UniProtQ8IV48|ERI1_HUMAN 3'-5' exoribonuclease 1 (Gene Name=ERI1)

[Back to BioLiP]