Structure of PDB 4l8h Chain B Binding Site BS01

Receptor Information
>4l8h Chain B (length=123) Species: 39803 (Qubevirus durum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVRALEKRVTV
SVSQPSRNRKNYKVQVKIQNPTAGVTRQAYADVTFSFTQYSTDEERAFVR
TELAALLASPLLIDAIDQLRPAY
Ligand information
>4l8h Chain R (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
augcaugucuaagacagcau
<<<<.<<<<...>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l8h Crystal structure of the bacteriophage q beta coat protein in complex with the RNA operator of the replicase gene.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		N58 R59 K60 N61 K63 Q65 K67 Y89 D91
Binding residue
(residue number reindexed from 1)		N58 R59 K60 N61 K63 Q65 K67 Y80 D82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0030371 translation repressor activity
Biological Process
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l8h, PDBe:4l8h, PDBj:4l8h
PDBsum4l8h
PubMed24035813
UniProtP03615|CAPSD_BPQBE Capsid protein

[Back to BioLiP]