Structure of PDB 4l5s Chain B Binding Site BS01

Receptor Information
>4l5s Chain B (length=198) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYR
VKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVP
KNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNED
NIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4l5s Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		S91 K92
Binding residue
(residue number reindexed from 1)		S46 K47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:4l5s, PDBe:4l5s, PDBj:4l5s
PDBsum4l5s
PubMed23850291
UniProtQ9R002|IFI2_MOUSE Interferon-activable protein 202 (Gene Name=Ifi202)

[Back to BioLiP]