Structure of PDB 4kb1 Chain B Binding Site BS01

Receptor Information

>4kb1 Chain B (length=205) Species: 83333 (Escherichia coli K-12)

LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDT
TLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKG
IKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAG
LALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGG
WPLSA

Ligand information

>4kb1 Chain C (length=18)

ggccctctttagggcctc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4kb1 Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): R15 R114 R140 N141 H144 F146
• Binding residue (residue number reindexed from 1): R9 R108 R134 N135 H138 F140

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4kb1, PDBe:4kb1, PDBj:4kb1
• PDBsum: 4kb1
• PubMed: 24594808
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)