Structure of PDB 4k7l Chain B Binding Site BS01

Receptor Information
>4k7l Chain B (length=102) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNC
YQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDA
SV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4k7l Crystal structure of RNase S with a [Hg(Cys2)] metal center in the S-peptide as a template for structure-based design of artificial metalloenzymes using peptide-protein complementation
Resolution1.38 Å
Binding residue
(original residue number in PDB)		Y25 M29 R33 N34 N44 T45 F46 V47 H48 E49 S50 L51 V54 P117 H119 F120
Binding residue
(residue number reindexed from 1)		Y3 M7 R11 N12 N22 T23 F24 V25 H26 E27 S28 L29 V32 P95 H97 F98
Enzymatic activity
Catalytic site (original residue number in PDB) K41 H119 F120 D121
Catalytic site (residue number reindexed from 1) K19 H97 F98 D99
Enzyme Commision number 4.6.1.18: pancreatic ribonuclease.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4k7l, PDBe:4k7l, PDBj:4k7l
PDBsum4k7l
PubMed
UniProtP61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)

[Back to BioLiP]