Structure of PDB 4jqg Chain B Binding Site BS01

Receptor Information
>4jqg Chain B (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLT
FTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFD
DDELWSLGKGVGYSLFLVAAHAFGHALGLDHSSVPEALMYPMYRFTEGPP
LHKDDVNGIRHLYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jqg Halogen Bonding Controls Selectivity of FRET Substrate Probes for MMP-9.
Resolution1.849 Å
Binding residue
(original residue number in PDB)		G106 Q108 T109 F110 Y179 G186 L187 L188 A189 H190 A191 F192 Y218 H226 H230 H236 P246 M247 Y248
Binding residue
(residue number reindexed from 1)		G1 Q3 T4 F5 Y74 G81 L82 L83 A84 H85 A86 F87 Y113 H121 H125 H131 P141 M142 Y143
Enzymatic activity
Catalytic site (original residue number in PDB) H226 A227 H230 H236
Catalytic site (residue number reindexed from 1) H121 A122 H125 H131
Enzyme Commision number 3.4.24.35: gelatinase B.
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jqg, PDBe:4jqg, PDBj:4jqg
PDBsum4jqg
PubMed24583051
UniProtP14780|MMP9_HUMAN Matrix metalloproteinase-9 (Gene Name=MMP9)

[Back to BioLiP]