Structure of PDB 4jo6 Chain B Binding Site BS01

Receptor Information
>4jo6 Chain B (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jo6 The structure of the SBP-Tag-streptavidin complex reveals a novel helical scaffold bridging binding pockets on separate subunits
Resolution1.75 Å
Binding residue
(original residue number in PDB)		N23 Q24 L25 S27 Y43 S45 V47 S52 W79 R84 S88 T90 W108 S112 W120 L124 D128
Binding residue
(residue number reindexed from 1)		N9 Q10 L11 S13 Y29 S31 V33 S38 W65 R70 S74 T76 W94 S98 W106 L110 D114
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4jo6, PDBe:4jo6, PDBj:4jo6
PDBsum4jo6
PubMed23633599
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]