Structure of PDB 4jmy Chain B Binding Site BS01

Receptor Information
>4jmy Chain B (length=182) Species: 40271 (Hepatitis C virus genotype 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHV
VGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Ligand information
>4jmy Chain D (length=13) Species: 11116 (Hepatitis C virus (isolate Japanese)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGSVVIVGRIILS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jmy Importance of the peptide scaffold of drugs that target the hepatitis C virus NS3 protease and its crucial bioactive conformation and dynamic factors.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		I3 T4 A5 Y6 S7 Q8 T10 R11 C16 T19 S20 D30 G31 E32 V33 V35 L36 S37 K62 T63 L64 A65 R92 M94
Binding residue
(residue number reindexed from 1)		I3 T4 A5 Y6 S7 Q8 T10 R11 C16 T19 S20 D30 G31 E32 V33 V35 L36 S37 K62 T63 L64 A65 R92 M94
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H57 D81 G137 S139
Enzyme Commision number 3.4.21.98: hepacivirin.
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jmy, PDBe:4jmy, PDBj:4jmy
PDBsum4jmy
PubMed
UniProtQ81817

[Back to BioLiP]