Structure of PDB 4jmr Chain B Binding Site BS01

Receptor Information
>4jmr Chain B (length=173) Species: 11641 (Human foamy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEEYELDVEALVVILRDRNIPRNPLHGEVIGLRLTEGWWGQIERFQMVRL
ILQNDDNEPLQRPRYEVIQRAVNPHTMFMISGPLAELQLAFQDLDLPEGP
LRFGPLANGHYVQGDPYSSSYRPVTMAETAQMTRDELEDVLNTQSEIEIQ
MINLLELYEVETRALRRQLAERS
Ligand information
>4jmr Chain F (length=17) Species: 11641 (Human foamy virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAPPMTLQQWIIWKKMN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jmr A Unique Spumavirus Gag N-terminal Domain with Functional Properties of Orthoretroviral Matrix and Capsid.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		V14 L17 P30 L31 L58 Q59 N63 P65 L66 Q67 P69
Binding residue
(residue number reindexed from 1)		V8 L11 P24 L25 L52 Q53 N57 P59 L60 Q61 P63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019076 viral release from host cell
GO:0046718 symbiont entry into host cell
GO:0075521 microtubule-dependent intracellular transport of viral material towards nucleus
Cellular Component
GO:0019028 viral capsid
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044163 host cytoskeleton

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4jmr, PDBe:4jmr, PDBj:4jmr
PDBsum4jmr
PubMed23675305
UniProtP14349|GAG_FOAMV Gag polyprotein (Gene Name=gag)

[Back to BioLiP]