Structure of PDB 4jjm Chain B Binding Site BS01

Receptor Information
>4jjm Chain B (length=169) Species: 2711 (Citrus sinensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKP
LHYKGSSFHRVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGP
GILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKV
GSSSGRTNKPVVIADCGQL
Ligand information
>4jjm Chain E (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTAGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4jjm A redox 2-cys mechanism regulates the catalytic activity of divergent cyclophilins.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		R62 F67 Q70 G79 A108 N109 A110 Q118 F120 W128 H133
Binding residue
(residue number reindexed from 1)		R60 F65 Q68 G77 A106 N107 A108 Q116 F118 W126 H131
Enzymatic activity
Catalytic site (original residue number in PDB) R62 F67 Q70 N109 F120 L129 H133
Catalytic site (residue number reindexed from 1) R60 F65 Q68 N107 F118 L127 H131
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4jjm, PDBe:4jjm, PDBj:4jjm
PDBsum4jjm
PubMed23709667
UniProtD0ELH5

[Back to BioLiP]