Structure of PDB 4jbm Chain B Binding Site BS01

Receptor Information

>4jbm Chain B (length=187) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MDPLVVTVLKAINPFECETQEGRQEIFHATVATETDFFFVKVLNAQFKDK
FIPKRTIKISNYLWHSNFMEVTSSSVVVDVESNHEVPNNVVKRARETPRI
SKLKIQPCGTIVNGLFKVQKITEEKDRVLYGIHDKTGTMEVLVLGNPSKT
KCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVIKA

Ligand information

>4jbm Chain T (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcgcgcgcgcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4jbm Structural basis for termination of AIM2-mediated signaling by p202
Resolution	2.218 Å
Binding residue (original residue number in PDB)	R95 R159
Binding residue (residue number reindexed from 1)	R95 R159

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0002218	activation of innate immune response
GO:0035458	cellular response to interferon-beta

View graph for
Biological Process

External links

PDB	RCSB:4jbm, PDBe:4jbm, PDBj:4jbm
PDBsum	4jbm
PubMed	23567559
UniProt	Q91VJ1\|AIM2_MOUSE Interferon-inducible protein AIM2 (Gene Name=Aim2)

[Back to BioLiP]