Structure of PDB 4j8r Chain B Binding Site BS01

Receptor Information
>4j8r Chain B (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLQESGGEVVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVI
NPGSGDTNYNEKFKGKATLTADKSSSTAYMQLNSLTSDDSAVYFCARSGA
AAPTYYAMDYWGQGVSVTVSSAKTTPPSVYPLAPAAAAANSMVTLGCLVK
GYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j8r The crystal structure of an octapeptide repeat of the Prion protein in complex with a Fab fragment of the POM2 antibody.
Resolution2.303 Å
Binding residue
(original residue number in PDB)		N58 P100 T100A Y100B Y100C A100D
Binding residue
(residue number reindexed from 1)		N58 P103 T104 Y105 Y106 A107
External links