Structure of PDB 4j24 Chain B Binding Site BS01

Receptor Information
>4j24 Chain B (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMI
SWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSM
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASN
KGMEHLLNMKCKNVVPVYDLLLEMLNAH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j24 Proline primed helix length as a modulator of the nuclear receptor-coactivator interaction
Resolution2.1 Å
Binding residue
(original residue number in PDB)		I310 K314 L324 Q327 V328 E332 D489 L490 E493
Binding residue
(residue number reindexed from 1)		I50 K54 L64 Q67 V68 E72 D219 L220 E223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4j24, PDBe:4j24, PDBj:4j24
PDBsum4j24
PubMed23437920
UniProtQ92731|ESR2_HUMAN Estrogen receptor beta (Gene Name=ESR2)

[Back to BioLiP]