Structure of PDB 4j1j Chain B Binding Site BS01

Receptor Information
>4j1j Chain B (length=231) Species: 999729 (Leanyer virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PDFIYDDRPAAVSSTFNPEKGYMDFITAYGKNINADNVRIFFLNHKKAKD
SLKGSPKVEVDLQFGTLRVKVVNNHNPRNRDNPVADNAITLHRLSGYLAK
WCFDEIDHGQIEEAEVKSKVVIPLAEAKGCKWGDGVALYLAFAPGAEMFL
KDFEFYPLAIDIQRVVKDGMDITFMRKVLKQRYGTKTADDWMISEVTAIQ
SAVKVVAKLPWAKAGFTAAAKNFLAKFNISV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4j1j Structure of the Leanyer orthobunyavirus nucleoprotein-RNA complex reveals unique architecture for RNA encapsidation.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		A14 A15 S17 S18 L47 K50 K53 N78 H79 D85 T94 H96 L128 E130 R168 M174 F178 K181 Q185
Binding residue
(residue number reindexed from 1)		A10 A11 S13 S14 L43 K46 K49 N74 H75 D81 T90 H92 L124 E126 R164 M170 F174 K177 Q181
Binding affinityPDBbind-CN: Kd=0.505uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4j1j, PDBe:4j1j, PDBj:4j1j
PDBsum4j1j
PubMed23569220
UniProtF2WAD7

[Back to BioLiP]