Structure of PDB 4ins Chain B Binding Site BS01

Receptor Information
>4ins Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ins The structure of 2Zn pig insulin crystals at 1.5 A resolution.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
F1 N3 Q4 H5 L6 C7 L11 C19 R22 G23 F24 F25 P28 K29
Binding residue
(residue number reindexed from 1)
F1 N3 Q4 H5 L6 C7 L11 C19 R22 G23 F24 F25 P28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4ins, PDBe:4ins, PDBj:4ins
PDBsum4ins
PubMed2905485
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]